PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462845363
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family HB-other
Protein Properties Length: 285aa    MW: 32420.1 Da    PI: 9.5371
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462845363genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.82.8e-211772156
               TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
               +++ +++t+ q+++Le++F+++++p++++r +L+++lgL+ rq+k+WFqNrR+++k
  462845363 17 KKRYHRHTPRQIQQLEAMFKECPHPDENQRMQLSRELGLEPRQIKFWFQNRRTQMK 72
               678899***********************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.05E-21674IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.0E-231179IPR009057Homeodomain-like
PROSITE profilePS5007118.0581474IPR001356Homeobox domain
SMARTSM003891.2E-191578IPR001356Homeobox domain
CDDcd000868.66E-191775No hitNo description
PfamPF000468.4E-191772IPR001356Homeobox domain
PRINTSPR000318.9E-54554IPR000047Helix-turn-helix motif
PROSITE patternPS0002704972IPR017970Homeobox, conserved site
PRINTSPR000318.9E-55470IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MDFGDDVMEG SDGQRRKKRY HRHTPRQIQQ LEAMFKECPH PDENQRMQLS RELGLEPRQI  60
KFWFQNRRTQ MKAQHERADN CFLRAENDKI RCENIAMREA LRNVICPTCG GPPVADDYFD  120
EQKLRMENAR LKEEASSHIL TRSSSFDGPV DDLISPLRSR LDRVSSLTSK YLGRPITQLP  180
PVQPLSMSSL DLSVGGLGSP ALGPKWMEFF PAIVSKARTI DVLVNGMAGR SESLVLVMTT  240
TNSRFHRYYV KVAQGLPTRV KNCACWCRAD VRGAARDVAG RPDAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7285231e-171KJ728523.1 Zea mays clone pUT6828 HB transcription factor (HB83) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004954072.11e-117PREDICTED: homeobox-leucine zipper protein ROC8-like
SwissprotQ69T581e-104ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLK3YQE01e-117K3YQE0_SETIT; Uncharacterized protein
STRINGSi016483m1e-116(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP15929915
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.12e-71homeodomain GLABROUS 11